PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_51510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family SBP
Protein Properties Length: 305aa    MW: 32782 Da    PI: 9.456
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_51510.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.72.2e-40201277177
                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                   +Cq+egC++dls ak+yhrrhkvCe h+ka++v++sg++qrfCqqCsrfh l efDe+krsCr+rL +hn+rrrk++
  MLOC_51510.1 201 RCQAEGCKTDLSAAKHYHRRHKVCEYHAKAATVAASGKQQRFCQQCSRFHVLAEFDEAKRSCRKRLTEHNRRRRKPA 277
                   6**************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.3E-34195263IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.026199276IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.31E-37200277IPR004333Transcription factor, SBP-box
PfamPF031101.3E-30202275IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MMSSRLNVGT MAPVSDVVDF GYAPIQSYPN FESAGLALPG DRQPPFQHHH LYDSFDFTSA  60
NFSFQDPAAL FSGDSALSNQ LQQPFVQSQV TMPTTASSSV LQMPMMTLPG MLMSSSSSLA  120
ADACTFGGGG GFLKREDGGP FSDIGGGGRI GLNLGRRTYF SPADVLAVDR LLMRSRFGGA  180
GPMGMLGLGL GAAAHHHQPP RCQAEGCKTD LSAAKHYHRR HKVCEYHAKA ATVAASGKQQ  240
RFCQQCSRFH VLAEFDEAKR SCRKRLTEHN RRRRKPAGAQ AGKDSPAPPT KKPDGSITSS  300
YTGDH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-292022751184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1258275KRSCRKRLTEHNRRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4478820.0KF447882.1 Triticum aestivum squamosa promoter-binding-like protein 21 (SPL21) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002451645.14e-91hypothetical protein SORBIDRAFT_04g005180
SwissprotQ0E3F84e-68SPL5_ORYSJ; Squamosa promoter-binding-like protein 5
TrEMBLM0WHE00.0M0WHE0_HORVD; Uncharacterized protein
STRINGMLOC_51510.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23753593
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.12e-41squamosa promoter binding protein-like 8